Skip to main content

Senior Full-Stack Developer (Python / React / AWS)

Technology
Codeminders
Дистанційно, Україна1 тижнів томуДо 10.08.2026
Повна зайнятістьВ офісі

Опис вакансії

About the Role

We are looking for an experienced Senior Full-Stack Developer to join our engineering team and help design, build, and scale modern cloud-native applications. The ideal candidate combines deep backend expertise in Python with strong frontend development skills, a solid understanding of distributed systems, and experience building highly scalable and reliable software solutions.

You will play a key role in architecture decisions, technical leadership, and the delivery of high-quality products while collaborating closely with cross-functional teams.

Key Responsibilities

  • Design, develop, and maintain scalable full-stack applications.
  • Build robust backend services using Python and FastAPI.
  • Develop modern frontend applications using ReactJS and TypeScript.
  • Design and implement RESTful and GraphQL APIs.
  • Build and maintain asynchronous processing systems using Celery or similar technologies.
  • Architect and implement cloud-native solutions on AWS.
  • Design scalable microservices and distributed systems.
  • Participate in system architecture, code reviews, and technical decision-making.
  • Implement CI/CD pipelines and DevOps best practices.
  • Ensure system reliability, performance, security, and maintainability.
  • Collaborate with product managers, designers, and engineering teams to deliver business value.
  • Leverage AI technologies and integrate AI capabilities into products where appropriate.

Required Skills

Backend Engineering

  • Strong expertise in Python development.
  • Extensive experience with FastAPI.
  • Strong understanding of REST API and GraphQL API design and development.
  • Experience building asynchronous processing workflows using Celery or similar frameworks.

Frontend Engineering

  • Strong expertise in ReactJS.
  • Advanced proficiency in TypeScript.
  • Experience building scalable, maintainable, and performant frontend applications.

Cloud & Infrastructure

  • Strong experience with AWS cloud services.
  • Hands-on experience with Docker and containerization technologies.
  • Experience deploying and managing applications in Kubernetes environments.
  • Understanding of cloud-native application architecture and operational best practices.

Architecture & System Design

  • Strong understanding of microservices architecture.
  • Experience designing distributed systems.
  • Ability to make architectural decisions balancing scalability, reliability, maintainability, and performance.
  • Familiarity with Domain-Driven Design (DDD) and clean architecture principles.

Databases & Data Management

  • Strong understanding of SQL databases.
  • Experience working with NoSQL databases.
  • Ability to design efficient data models and optimize database performance.

DevOps & Reliability

  • Experience designing and maintaining CI/CD pipelines.
  • Knowledge of monitoring, logging, and observability frameworks.
  • Experience troubleshooting production environments and ensuring system reliability.

Additional Requirements

  • Experience building AI-powered applications or integrating AI capabilities into software products.
  • Experience with event-driven architectures and messaging systems such as Kafka, SNS, or SQS.
  • Knowledge of Infrastructure as Code (Terraform, CloudFormation, or equivalent).
  • Experience with performance optimization, load testing, and scalability improvements.
  • Experience managing and optimizing AWS infrastructure costs.
  • Strong problem-solving and analytical skills.
  • Ability to work independently and take ownership of technical initiatives.
  • Excellent communication and collaboration skills.

Nice to Have

  • Experience working in high-growth or startup environments.
  • Experience with large-scale SaaS platforms.
  • Knowledge of security best practices for cloud-native applications.
  • Experience mentoring engineers and providing technical leadership.
  • Experience with multi-region or globally distributed systems.
Send your Resume / CV to apply online (https://jobs.codeminders.com/p/1735ab231e97-senior-full-stack-developer-python-react-aws/apply) Founded in California in 2004, Codeminders specializes in developing cutting-edge software solutions for high-tech companies in the Silicon Valley of California. Our expertise spans a wide range of industries, with a primary focus on modern technologies such as AI, mobile applications, video conferencing, and cloud computing.

As a member of the Codeminders team, you'll have the unique opportunity to work on innovative projects. Whether it's collaborating with dynamic startups or established companies serving millions of users, every project is a chance to shape the future of technology.

Why Codeminders?

We believe in empowering our team members with the tools, opportunities, and culture to thrive. Here's what you can expect when you join us:
  • Innovation at Its Core: Work on transformative projects that utilize the latest technologies, tools, and methodologies.
  • Global Collaboration: Partner with world-class engineers from both the US and Ukraine, fostering diverse perspectives and international exposure.
  • Strong Ethical Foundation: We stand firm in our values by maintaining zero business ties with Russia, Belarus, and temporarily occupied Ukrainian territories (Crimea, Donbas, etc.).

Employee Benefits:

We offer a robust package designed to support your professional and personal growth:
  • Competitive Compensation: Your salary is based on your qualifications, experience, and performance.
  • Exceptional Stability: Enjoy job security and ample opportunities for career progression.
  • Professional Development: Access educational programs and certifications to expand your expertise.
  • Health & Wellness: Comprehensive support for fitness.
  • Flexible Working Environment: Benefit from a fully remote work setup, flexible schedules, and relocation assistance if needed.
  • Performance Recognition: Regular bonuses, annual salary reviews, and recognition for your achievements.
  • Advanced Equipment Options: Choose the workstation setup that fits your needs, whether a desktop or a laptop.
  • Team Building & Community: Participate in regular events that foster collaboration, camaraderie, and innovation.
Keywords
pythonreact-jsreactamazon-web-servicesplanning-and-designvisual-art-designproduct-development-and-designfastapitypescriptmicrosoft-typescriptgraphqlcelerymicroservicesdistributed-computingsystem-architecturecode-reviewcustomer-intelligence-cicontinuous-integrationcd-certificate-of-depositci-cddevelopment-operations-devopspolicies-and-practicesartificial-intelligencetraining-and-developmentapplication-programming-interface-apirestful-apiapi-designcloud-servicesdockercontainerizationkubernetesnative-cloud-application-ncaapplications-architecturemicro-services-architecturescalabilitydata-managementsqlnosqlobservabilitytroubleshootingtrade-shows-eventskafkainfrastructure-as-code-iacterraformperformance-optimizationtesting-and-analysisperformance-testingload-testingstartupssoftware-as-a-service-saas-based-accountingsoftware-as-a-service-saasmentoringcoaching-mentoringemployee-benefitsprofessional-developmentseminars-and-educational-programstraining-certificationenvironment-health-and-safety-hssehealth-promotion-recreation-wellness-benefitsflexible-workingecology-environmentremote-workingworkstationsteam-buildingbreezy-hr

Вас цікавить ця вакансія?